Skip to product information
1 of 1

GeneBio Systems

Recombinant Human Nitric oxide synthase, inducible (NOS2), partial

Recombinant Human Nitric oxide synthase, inducible (NOS2), partial

SKU:P35228

Regular price £583.00 GBP
Regular price Sale price £583.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Cancer

Uniprot ID: P35228

Gene Names: NOS2

Alternative Name(s): (Hepatocyte NOS)(HEP-NOS)(Inducible NO synthase)(Inducible NOS)(iNOS)(NOS type II)(Peptidyl-cysteine S-nitrosylase NOS2)

Abbreviation: Recombinant Human NOS2 protein, partial

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 1-200aa

Protein Length: Partial

Tag Info: N-terminal 6xHis-tagged

Target Protein Sequence: MACPWKFLFKTKFHQYAMNGEKDINNNVEKAPCATSSPVTQDDLQYHNLSKQQNESPQPLVETGKKSPESLVKLDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIMTPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQLTGDELIFATKQAWRNAPRC

MW: 26.6 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Produces nitric oxide (NO) which is a messenger molecule with diverse functions throughout the body . In macrophages, NO mediates tumoricidal and bactericidal actions. Also has nitrosylase activity and mediates cysteine S-nitrosylation of cytoplasmic target proteins such PTGS2/COX2. As component of the iNOS-S100A8/9 transnitrosylase complex involved in the selective inflammatory stimulus-dependent S-nitrosylation of GAPDH on 'Cys-247' implicated in regulation of the GAIT complex activity and probably multiple targets including ANXA5, EZR, MSN and VIM . Involved in inflammation, enhances the synthesis of proinflammatory mediators such as IL6 and IL8 .

Reference: "Target-selective protein S-nitrosylation by sequence motif recognition." Jia J., Arif A., Terenzi F., Willard B., Plow E.F., Hazen S.L., Fox P.L. Cell 159: 623-634(2014)

Function:

View full details