Recombinant Human Nephrin(NPHS1),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Nephrin(NPHS1),partial

CSB-EP015988HU
Regular price
£531.00 GBP
Sale price
£531.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171018

Research areas: Cell Adhesion

Target / Protein: NPHS1

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Homo sapiens (Human)

Delivery time: 3-7 business days

Uniprot ID: O60500

AA Sequence: QLAIPASVPRGFWALPENLTVVEGASVELRCGVSTPGSAVQWAKDGLLLGPDPRIPGFPRYRLEGDPARGEFHLHIEACDLSDDAEYECQVGRSEMGPELVSPRVILSILVPPKLLLLTPEAGTMVTWVAGQEYVVNCVSGDAKPAPDITILLSGQTISDISANVNEGSQQKLFTVEATARVTPRSSDNRQLLVCEASSPALEAPIKASFTVNVLFPPGPPVIEWPGLDEGHVRA

Tag info: N-terminal 6xHis-tagged

Expression Region: 23-257aa

Protein length: Partial

MW: 29.1 kDa

Alternative Name(s): Renal glomerulus-specific cell adhesion receptor

Relevance: Ses to play a role in the development or function of the kidney glomerular filtration barrier. Regulates glomerular vascular permeability. May anchor the podocyte slit diaphragm to the actin cytoskeleton. Plays a role in skeletal muscle formation through regulation of myoblast fusion .

Reference: A spectrum of novel NPHS1 and NPHS2 gene mutations in pediatric nephrotic syndrome patients from Pakistan.Abid A., Khaliq S., Shahid S., Lanewala A., Mubarak M., Hashmi S., Kazi J., Masood T., Hafeez F., Naqvi S.A., Rizvi S.A., Mehdi S.Q.Gene 502:133-137(2012)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Human Nephrin(NPHS1) ,partial
    Regular price
    £531.00 GBP
    Sale price
    £531.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Nephrin(NPHS1),partial
    Regular price
    £548.00 GBP
    Sale price
    £548.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Nephrin(NPHS1),partial
    Regular price
    £548.00 GBP
    Sale price
    £548.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Nephrin
    Regular price
    £501.00 GBP
    Sale price
    £501.00 GBP
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share