Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human NEDD4 family-interacting protein 1(NDFIP1)

Recombinant Human NEDD4 family-interacting protein 1(NDFIP1)

SKU:CSB-CF887119HU

Regular price £1,314.00 GBP
Regular price Sale price £1,314.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q9BT67

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MALALAALAAVEPACGSRYQQLQNEEESGEPEQAAGDAPPPYSSISAESAAYFDYKDESG FPKPPSYNVATTLPSYDEAERTKAEATIPLVPGRDEDFVGRDDFDDADQLRIGNDGIFML TFFMAFLFNWIGFFLSFCLTTSAAGRYGAISGFGLSLIKWILIVRFSTYFPGYFDGQYWL WWVFLVLGFLLFLRGFINYAKVRKMPETFSNLPRTRVLFIY

Protein Names:Recommended name: NEDD4 family-interacting protein 1 Alternative name(s): Breast cancer-associated protein SGA-1M NEDD4 WW domain-binding protein 5 Putative MAPK-activating protein PM13 Putative NF-kappa-B-activating protein 164 Pu

Gene Names:Name:NDFIP1 Synonyms:N4WBP5 ORF Names:PSEC0192, PSEC0223

Expression Region:1-221

Sequence Info:full length protein

View full details