Gene Bio Systems
Recombinant Human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13(NDUFA13)
Recombinant Human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13(NDUFA13)
SKU:CSB-CF889167HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:Q9P0J0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:AASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQ IEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLI GELYGLRTTEEALHASHGFMWYT
Protein Names:Recommended name: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 Alternative name(s): Cell death regulatory protein GRIM-19 Complex I-B16.6 Short name= CI-B16.6 Gene associated with retinoic and interferon-induced mor
Gene Names:Name:NDUFA13 Synonyms:GRIM19 ORF Names:CDA016, CGI-39
Expression Region:2-144
Sequence Info:full length protein
![Recombinant Human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13(NDUFA13)](http://www.genebiosystems.com/cdn/shop/products/no_image_default_image-jpeg_4b7760e6-fcb9-4893-9bd7-a0e93d77a4f0.jpg?v=1659245394&width=1445)