![Recombinant Human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12(NDUFA12)](http://www.genebiosystems.com/cdn/shop/products/no_image_default_image-jpeg_842c3f53-dde1-4f3b-8f4e-f9407ec7f641_180x.jpg?v=1659194010 180w, //www.genebiosystems.com/cdn/shop/products/no_image_default_image-jpeg_842c3f53-dde1-4f3b-8f4e-f9407ec7f641_360x.jpg?v=1659194010 360w, //www.genebiosystems.com/cdn/shop/products/no_image_default_image-jpeg_842c3f53-dde1-4f3b-8f4e-f9407ec7f641_540x.jpg?v=1659194010 540w, //www.genebiosystems.com/cdn/shop/products/no_image_default_image-jpeg_842c3f53-dde1-4f3b-8f4e-f9407ec7f641_720x.jpg?v=1659194010 720w, //www.genebiosystems.com/cdn/shop/products/no_image_default_image-jpeg_842c3f53-dde1-4f3b-8f4e-f9407ec7f641_900x.jpg?v=1659194010 900w, //www.genebiosystems.com/cdn/shop/products/no_image_default_image-jpeg_842c3f53-dde1-4f3b-8f4e-f9407ec7f641_1080x.jpg?v=1659194010 1080w, //www.genebiosystems.com/cdn/shop/products/no_image_default_image-jpeg_842c3f53-dde1-4f3b-8f4e-f9407ec7f641_1296x.jpg?v=1659194010 1296w, //www.genebiosystems.com/cdn/shop/products/no_image_default_image-jpeg_842c3f53-dde1-4f3b-8f4e-f9407ec7f641_1512x.jpg?v=1659194010 1512w, //www.genebiosystems.com/cdn/shop/products/no_image_default_image-jpeg_842c3f53-dde1-4f3b-8f4e-f9407ec7f641_1728x.jpg?v=1659194010 1728w, //www.genebiosystems.com/cdn/shop/products/no_image_default_image-jpeg_842c3f53-dde1-4f3b-8f4e-f9407ec7f641_2048x.jpg?v=1659194010 2048w)
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Signal Transduction
Uniprot ID: Q9UI09
Gene Names: NDUFA12
Organism: Homo sapiens (Human)
AA Sequence: MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGRHRWVVYTTEMNGKNTFWDVDGSMVPPEWHRWLHSMTDDPPTTKPLTARKFIWTNHKFNVTGTPEQYVPYSTTRKKIQEWIPPSTPYK
Expression Region: 1-145aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 44.1 kDa
Alternative Name(s): 13KDA differentiation-associated protein Complex I-B17.2
Relevance: Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Reference: "Characterization of the human complex I NDUFB7 and 17.2-KDA cDNAs and mutational analysis of 19 genes of the HP fraction in complex I-deficient-patients." Triepels R., Smeitink J., Loeffen J., Smeets R., Trijbels F., van den Heuvel L. Hum. Genet. 106:385-391(2000)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7(NDUFB7)
- Regular price
- £423.00 GBP
- Sale price
- £423.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10(NDUFB10)
- Regular price
- £423.00 GBP
- Sale price
- £423.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial(NDUFV2),partial
- Regular price
- £423.00 GBP
- Sale price
- £423.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human NADH dehydrogenase [ubiquinone] iron-sulfur protein 5(NDUFS5)
- Regular price
- £423.00 GBP
- Sale price
- £423.00 GBP
- Regular price
-
- Unit price
- per
Sold out