Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Myosin light polypeptide 6(MYL6),partial

Recombinant Human Myosin light polypeptide 6(MYL6),partial

SKU:CSB-RP051544h

Regular price £594.00 GBP
Regular price Sale price £594.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Signal Transduction

Uniprot ID: P60660

Gene Names: MYL6

Organism: Homo sapiens (Human)

AA Sequence: DFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCINYEAFVRHILSG

Expression Region: 3-151aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 43.7 kDa

Alternative Name(s): 17KDA myosin light chain ;LC17Myosin light chain 3 ;MLC-3Myosin light chain alkali 3 ;Myosin light chain A3Smooth muscle and nonmuscle myosin light chain alkali 6

Relevance: Regulatory light chain of myosin. Does not bind calcium.

Reference: The alkali light chains of human smooth and nonmuscle myosins are encoded by a single gene. Tissue-specific expression by alternative splicing pathways.Lenz S., Lohse P., Seidel U., Arnold H.H.J. Biol. Chem. 264:9009-9015(1989)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details