Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Myelin protein zero-like protein 1(MPZL1)

Recombinant Human Myelin protein zero-like protein 1(MPZL1)

SKU:CSB-CF014775HU

Regular price £1,322.00 GBP
Regular price Sale price £1,322.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:O95297

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SALEVYTPKEIFVANGTQGKLTCKFKSTSTTGGLTSVSWSFQPEGADTTVSFFHYSQGQVYLGNYPPFKDRISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQPGHIRLYVVEKENLPVFPVWVVVGIVTAVVLGLTLLISMILAVLYRRKNSKRDYTGCSTSESLSPVKQAPRKSPSDTEGLVKSLPSGSHQGPVIYAQLDHSGGHHSDKINKSESVVYADIRKN

Protein Names:Recommended name: Myelin protein zero-like protein 1 Alternative name(s): Protein zero-related

Gene Names:Name:MPZL1 Synonyms:PZR ORF Names:UNQ849/PRO1787

Expression Region:36-269

Sequence Info:full length protein

View full details