Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Myelin and lymphocyte protein(MAL)

Recombinant Human Myelin and lymphocyte protein(MAL)

SKU:CSB-CF013372HU

Regular price £1,250.00 GBP
Regular price Sale price £1,250.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P21145

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAPAAATGGSTLPSGFSVFTTLPDLLFIFEFIFGGLVWILVASSLVPWPLVQGWVMFVSV FCFVATTTLIILYIIGAHGGETSWVTLDAAYHCTAALFYLSASVLEALATITMQDGFTYR HYHENIAAVVFSYIATLLYVVHAVFSLIRWKSS

Protein Names:Recommended name: Myelin and lymphocyte protein Alternative name(s): T-lymphocyte maturation-associated protein

Gene Names:Name:MAL

Expression Region:1-153

Sequence Info:Full length protein

View full details