Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Motile sperm domain-containing protein 3(MOSPD3)

Recombinant Human Motile sperm domain-containing protein 3(MOSPD3)

SKU:CSB-CF014738HU

Regular price £1,297.00 GBP
Regular price Sale price £1,297.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:O75425

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRRGAPQDQELVGPGPPGRGSRGAPPPLGPVVPVLVFPPDLVFRADQRSGPRQLLTLYNP TGTALRFRVLCTAPAKYTVFDAEGYVKPQSCIDIVIRHVAPIPSHYDVQDRFRIELSEEG AEGRVVGRKDITSILRAPAYPLELQGQPDPAPRPGPPAGTPPPTARHFQEHPRQQLATSS FLLFLLTGIVSVAFLLLPLPDELGSQLPQVLHVSLGQKLVAAYVLGLLTMVFLRT

Protein Names:Recommended name: Motile sperm domain-containing protein 3

Gene Names:Name:MOSPD3

Expression Region:1-235

Sequence Info:Full length protein

View full details