Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human MLN64 N-terminal domain homolog(STARD3NL)

Recombinant Human MLN64 N-terminal domain homolog(STARD3NL)

SKU:CSB-CF022802HU

Regular price £1,297.00 GBP
Regular price Sale price £1,297.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:O95772

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNHLPEDMENALTGSQSSHASLRNIHSINPTQLMARIESYEGREKKGISDVRRTFCLFVT FDLLFVTLLWIIELNVNGGIENTLEKEVMQYDYYSSYFDIFLLAVFRFKVLILAYAVCRL RHWWAIALTTAVTSAFLLAKVILSKLFSQGAFGYVLPIISFILAWIETWFLDFKVLPQEA EEENRLLIVQDASERAALIPGGLSDGQFYSPPESEAGSEEAEEKQDSEKPLLEL

Protein Names:Recommended name: MLN64 N-terminal domain homolog Alternative name(s): STARD3 N-terminal-like protein

Gene Names:Name:STARD3NL Synonyms:MENTHO ORF Names:UNQ855/PRO1864

Expression Region:1-234

Sequence Info:Full length protein

View full details