Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Mitochondrial import inner membrane translocase subunit Tim17-B(TIMM17B)

Recombinant Human Mitochondrial import inner membrane translocase subunit Tim17-B(TIMM17B)

SKU:CSB-EP023551HU

Regular price £760.00 GBP
Regular price Sale price £760.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Signal Transduction

Uniprot ID: O60830

Gene Names: TIMM17B

Organism: Homo sapiens (Human)

AA Sequence: MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVGIRHRLRGSANAVRIRAPQIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAARSGPLAMVGSAMMGGILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLPPKDGTPAPGYPSYQQYH

Expression Region: 1-172aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 45.3 kDa

Alternative Name(s):

Relevance: Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.

Reference: "Genetic and structural characterization of the human mitochondrial inner membrane translocase." Bauer M.F., Gempel K., Reichert A.S., Rappold G.A., Lichtner P., Gerbitz K.-D., Neupert W., Brunner M., Hofmann S. J. Mol. Biol. 289:69-82(1999)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details