Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Methionine-R-sulfoxide reductase B3(MSRB3)

Recombinant Human Methionine-R-sulfoxide reductase B3(MSRB3)

SKU:CSB-EP810290HU-GB

Regular price £581.00 GBP
Regular price Sale price £581.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Signal Transduction

Uniprot ID: Q8IXL7

Gene Names: MSRB3

Organism: Homo sapiens (Human)

AA Sequence: MSAFNLLHLVTKSQPVALRACGLPSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYCINSAALSFTPADSSGTAEGGSGVASPAQADKAEL

Expression Region: 1-185aa

Sequence Info: Full Length of Isoform 2

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 47 kDa

Alternative Name(s):

Relevance: Catalyzes the reduction of free and protein-bound methionine sulfoxide to methionine. Isoform 2 is essential for hearing.

Reference: "Methionine sulfoxide reduction in mammals: characterization of methionine-R-sulfoxide reductases." Kim H.-Y., Gladyshev V.N. Mol. Biol. Cell 15:1055-1064(2004)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details