Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human metapneumovirus Major surface glycoprotein G(G)

Recombinant Human metapneumovirus Major surface glycoprotein G(G)

SKU:CSB-CF754440HDAM

Regular price £1,312.00 GBP
Regular price Sale price £1,312.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Human metapneumovirus (strain CAN97-83) (HMPV)

Uniprot NO.:Q6WB94

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEVKVENIRAIDMLKARVKNRVARSKCFKNASLILIGITTLSIALNIYLIINYTIQKTSS ESEHHTSSPPTESNKEASTISTDNPDINPNSQHPTQQSTENPTLNPAASVSPSETEPAST PDTTNRLSSVDRSTAQPSESRTKTKPTVHTRNNPSTASSTQSPPRATTKAIRRATTFRMS STGKRPTTTSVQSDSSTTTQNHEETGSANPQASVSTMQN

Protein Names:Recommended name: Major surface glycoprotein G Alternative name(s): Attachment glycoprotein G Membrane-bound glycoprotein Short name= mG

Gene Names:Name:G

Expression Region:1-219

Sequence Info:full length protein

View full details