Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Metallothionein-1G(MT1G),partial

Recombinant Human Metallothionein-1G(MT1G),partial

SKU:CSB-RP173844h

Regular price £580.00 GBP
Regular price Sale price £580.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Cancer

Uniprot ID: P13640

Gene Names: MT1G

Organism: Homo sapiens (Human)

AA Sequence: MDPNCSCAAAGVSCTCASSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASEKCS

Expression Region: 1-59aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 32.9 kDa

Alternative Name(s): Metallothionein-1K ;MT-1KMetallothionein-IG ;MT-IG

Relevance: Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.

Reference: Induction by zinc of specific metallothionein isoforms in human monocytes.Pauwels M., van Weyenbergh J., Soumillion A., Proost P., Ley M.Eur. J. Biochem. 220:105-110(1994)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details