Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Membrane-spanning 4-domains subfamily A member 15(MS4A15)

Recombinant Human Membrane-spanning 4-domains subfamily A member 15(MS4A15)

SKU:CSB-CF839805HU

Regular price £1,189.00 GBP
Regular price Sale price £1,189.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q8N5U1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSAAPASNGVFVVIPPNNASGLCPPPAILPTSMCQPPGIMQFEEPPLGAQTPRATQPPDL RPVETFLTGEPKVLGTVQILIGLIHLGFGSVLLMVRRGHVGIFFIEGGVPFWGGACFIIS GSLSVAAEKNHTSCLVRSSLGTNILSVMAAFAGTAILLMDFGVTNRDVDRGYLAVLTIFT VLEFFTAVIAMHFGCQAIHAQASAPVIFLPNAFSADFNIPSPAASAPPAYDNVAYAQGVV

Protein Names:Recommended name: Membrane-spanning 4-domains subfamily A member 15

Gene Names:Name:MS4A15

Expression Region:1-240

Sequence Info:full length protein

View full details