Recombinant Human Lymphocyte antigen 6E (LY6E) (Active)

SKU: Q16553

Size: 100ug. Other sizes are also available.

Activity: Yes

Research Areas: Cell Biology

Uniprot ID: Q16553

Gene Names: LY6E

Alternative Name(s): Lymphocyte antigen 6E; Ly-6E;Retinoic acid-induced gene E protein (RIG-E); Stem cell antigen 2 (SCA-2); Thymic shared antigen 1 (TSA-1); LY6E; 9804, RIGE, SCA2, TSA1

Abbreviation: Recombinant Human LY6E protein (Active)

Organism: Homo sapiens (Human)

Source: Mammalian cell

Expression Region: 21-101aa

Protein Length: Full Length of Mature Protein

Tag Info: N-terminal hFc-tagged

Target Protein Sequence: LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFS

MW: 34.6 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/μg as determined by LAL method.

Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Human LY6E protein at 2 μg/mL can bind Anti-LY6E recombinant antibody (CSB-RA619076MA1HU). The EC50 is 2.483-3.282 ng/mL.

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: GPI-anchored cell surface protein that regulates T-lymphocytes proliferation, differentiation, and activation. Regulates the T-cell receptor (TCR) signaling by interacting with component CD3Z/CD247 at the plasma membrane, leading to CD3Z/CD247 phosphorylation modulation. Restricts the entry of human coronaviruses, including SARS-CoV, MERS-CoV and SARS-CoV-2, by interfering with spike protein-mediated membrane fusion.

Reference: Innovative biomarkers TCN2 and LY6E can significantly inhibit respiratory syncytial virus infection. Cao B., Li M., Li X., Ji X., Wan L., Jiang Y., Zhou L., Gong F., Chen X. J Transl Med 22: 854-854 (2024)

Function: