Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Low affinity immunoglobulin gamma Fc region receptor II-c(FCGR2C)

Recombinant Human Low affinity immunoglobulin gamma Fc region receptor II-c(FCGR2C)

SKU:CSB-CF008542HU

Regular price £1,364.00 GBP
Regular price Sale price £1,364.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P31995

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:TPAAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPSSSPMGIIVAVVTGIAVAAIVAAVVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQPEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN

Protein Names:Recommended name: Low affinity immunoglobulin gamma Fc region receptor II-c Short name= IgG Fc receptor II-c Alternative name(s): CDw32 Fc-gamma RII-c Short name= Fc-gamma-RIIc Short name= FcRII-c CD_antigen= CD32

Gene Names:Name:FCGR2C Synonyms:CD32, FCG2, IGFR2

Expression Region:43-323

Sequence Info:full length protein

View full details