Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Leucine-rich repeat-containing protein 3(LRRC3)

Recombinant Human Leucine-rich repeat-containing protein 3(LRRC3)

SKU:CSB-CF861170HU

Regular price £1,287.00 GBP
Regular price Sale price £1,287.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q9BY71

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:CPQPCRCPDHAGAVAVFCSLRGLQEVPEDIPANTVLLKLDANKISHLPDGAFQHLHRLRE LDLSHNAIEAIGSATFAGLAGGLRLLDLSYNRIQRIPKDALGKLSAKIRLSHNPLHCECA LQEALWELKLDPDSVDEIACHTSVQEEFVGKPLVQALDAGASLCSVPHRTTDVAMLVTMF GWFAMVIAYVVYYVRHNQEDARRHLEYLKSLPSAPASKDPIGPGP

Protein Names:Recommended name: Leucine-rich repeat-containing protein 3

Gene Names:Name:LRRC3 Synonyms:C21orf102, LRRC3A ORF Names:UNQ9233/PRO31982

Expression Region:33-257

Sequence Info:full length protein

View full details