Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Leucine-rich repeat-containing protein 3C(LRRC3C)

Recombinant Human Leucine-rich repeat-containing protein 3C(LRRC3C)

SKU:CSB-CF408988HU

Regular price £1,325.00 GBP
Regular price Sale price £1,325.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:A6NJW4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:VPSPQVPPRGCYVAKEAGERTFRCSQAGLSAVPSGIPNDTRKLYLDANQLASVPAGAFQH LPVLEELDLSHNALAHLSGAAFQGLEGTLRHLDLSANQLASVPVEAFVGLQIQVNLSANP WHCDCALQEVLRQVRLVPGTGTGIVCGSGARPDLVGQEFLLLAGEEELCGSGWGGARRST DVALLVTMGGWLTLMVAYLVHYVWQNRDETRRSLKRAPVLPVRSEDSSILSTVV

Protein Names:Recommended name: Leucine-rich repeat-containing protein 3C

Gene Names:Name:LRRC3C

Expression Region:42-275

Sequence Info:full length protein

View full details