Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Killer cell immunoglobulin-like receptor 3DL1(KIR3DL1)

Recombinant Human Killer cell immunoglobulin-like receptor 3DL1(KIR3DL1)

SKU:CSB-CF012364HU

Regular price £1,487.00 GBP
Regular price Sale price £1,487.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P43629

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:HMGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHIPIFHGRIFQESFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPVVIMVTGNHRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEGISKDPSRLVGQIHDGVSKANFSIGPMMLALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGPYEKPSLSAQPGPKVQAGESVTLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGPATHGGTYRCFGSFRHSPYEWSDPSDPLLVSVTGNPSSSWPSPTEPSSKSGNPRHLHILIGTSVVIILFILLLFFLLHLWCSNKKNAAVMDQEPAGNRTANSEDSDEQDPEEVTYAQLDHCVFTQRKITRPSQRPKTPPTDTILYTELPNAKPRSKVVSCP

Protein Names:Recommended name: Killer cell immunoglobulin-like receptor 3DL1 Alternative name(s): CD158 antigen-like family member E HLA-BW4-specific inhibitory NK cell receptor MHC class I NK cell receptor Natural killer-associated transcript 3 Short name= NKAT-3 p70 natural killer cell receptor clones CL-2/CL-11 Short name= p70 NK receptor CL-2/CL-11 CD_antigen= CD158e

Gene Names:Name:KIR3DL1 Synonyms:CD158E, NKAT3, NKB1

Expression Region:22-444

Sequence Info:full length protein

View full details