Recombinant Human Killer cell immunoglobulin-like receptor 2DS2(KIR2DS2)

SKU: CSB-CF012360HU

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P43631

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFEHFLLHREGKYKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLHVLIGTSVVKIPFTILLFFLLHRWCSNKKNAAVMDQEPAGNRTVNSEDSDEQDHQEVSYA

Protein Names:Recommended name: Killer cell immunoglobulin-like receptor 2DS2 Alternative name(s): CD158 antigen-like family member J MHC class I NK cell receptor NK receptor 183 ActI Natural killer-associated transcript 5 Short name= NKAT-5 p58 natural killer cell receptor clone CL-49 Short name= p58 NK receptor CL-49 CD_antigen= CD158j

Gene Names:Name:KIR2DS2 Synonyms:CD158J, NKAT5

Expression Region:22-304

Sequence Info:full length protein