Gene Bio Systems
Recombinant Human Killer cell immunoglobulin-like receptor 2DL2(KIR2DL2)
Recombinant Human Killer cell immunoglobulin-like receptor 2DL2(KIR2DL2)
SKU:CSB-CF012353HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:P43627
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVRFEHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHECRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVIGNPSNSWPSPTEPSSKTGNPRHLHILIGTSVVIILFILLFFLLHRWCSNKKNAAVMDQESAGNRTANSEDSDEQDPQEVTYTQLNHCVFTQRKITRPSQRPKTPPTDIIVYAELPNAESRSKVVSCP
Protein Names:Recommended name: Killer cell immunoglobulin-like receptor 2DL2 Alternative name(s): CD158 antigen-like family member B1 MHC class I NK cell receptor Natural killer-associated transcript 6 Short name= NKAT-6 p58 natural killer cell receptor clone CL-43 Short name= p58 NK receptor CL-43 CD_antigen= CD158b1
Gene Names:Name:KIR2DL2 Synonyms:CD158B1, NKAT6
Expression Region:22-348
Sequence Info:full length protein
