
Size:100ug. Other sizes are also available. For further information, please contact us.
Research Areas:Immunology
Uniprot ID:P35225
Gene Names:IL13
Organism:Homo sapiens (Human)
AA Sequence:TVIALTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDL
Expression Region:21-132aa
Sequence Info:Partial
Source:Mammalian cell
Tag Info:C-terminal hFc-Myc-tagged
MW:42
Alternative Name(s):IL-13
Relevance:Cytokine. Inhibits inflammatory cytokine production. Synergizes with IL2 in regulating interferon-gamma synthesis. May be critical in regulating inflammatory and immune responses. Positively regulates IL31RA expression in macrophages.
Reference:"Coexpression of the interleukin-13 and interleukin-4 genes correlates with their physical linkage in the cytokine gene cluster on human chromosome 5q23-31." Dolganov G., Bort S., Lovett M., Burr J., Schubert L., Short D., McGurn M., Gibson C., Lewis D.B. Blood 87:3316-3326(1996)
Purity:Greater than 85% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
Lead Time Guidance:18-28 business days
You may also like
-
Recombinant Human Interleukin-31(IL31)
- Regular price
- £387.00 GBP
- Sale price
- £387.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Interleukin-13 protein(Il13),partial (Active)
- Regular price
- £1,465.00 GBP
- Sale price
- £1,465.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Interleukin-13 receptor subunit alpha-1(IL13RA1)
- Regular price
- £1,321.00 GBP
- Sale price
- £1,321.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Rhesus Macaque Interleukin-13 protein(IL13) (Active)
- Regular price
- £1,743.00 GBP
- Sale price
- £1,743.00 GBP
- Regular price
-
- Unit price
- per
Sold out