Gene Bio Systems
Recombinant Human Interferon-induced transmembrane protein 5(IFITM5)
Recombinant Human Interferon-induced transmembrane protein 5(IFITM5)
SKU:CSB-CF011028HU-GB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:A6NNB3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDTAYPREDTRAPTPSKAGAHTALTLGAPHPPPRDHLIWSVFSTLYLNLCCLGFLALAYS IKARDQKVVGDLEAARRFGSKAKCYNILAAMWTLVPPLLLLGLVVTGALHLARLAKDSAA FFSTKFDDADYD
Protein Names:Recommended name: Interferon-induced transmembrane protein 5 Alternative name(s): Bone-restricted interferon-induced transmembrane protein-like protein Short name= BRIL
Gene Names:Name:IFITM5
Expression Region:1-132
Sequence Info:Full length protein
