Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Interferon alpha-14(IFNA14)

Recombinant Human Interferon alpha-14(IFNA14)

SKU:CSB-EP011035HU-GB

Regular price £531.00 GBP
Regular price Sale price £531.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Immunology

Uniprot ID: P01570

Gene Names: IFNA14

Organism: Homo sapiens (Human)

AA Sequence: CNLSQTHSLNNRRTLMLMAQMRRISPFSCLKDRHDFEFPQEEFDGNQFQKAQAISVLHEMMQQTFNLFSTKNSSAAWDETLLEKFYIELFQQMNDLEACVIQEVGVEETPLMNEDSILAVKKYFQRITLYLMEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD

Expression Region: 24-189aa

Sequence Info: Full Length of Mature Protein

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 35.7 kDa

Alternative Name(s): Interferon alpha-H

Relevance: Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.

Reference: "The structure of eight distinct cloned human leukocyte interferon cDNAs." Goeddel D.V., Leung D.W., Dull T.J., Gross M., Lawn R.M., McCandliss R., Seeburg P.H., Ullrich A., Yelverton E., Gray P.W. Nature 290:20-26(1981)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details