Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Immortalization up-regulated protein(IMUP)

Recombinant Human Immortalization up-regulated protein(IMUP)

SKU:CSB-EP003450HU

Regular price £531.00 GBP
Regular price Sale price £531.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Epigenetics and Nuclear Signaling

Uniprot ID: Q9GZP8

Gene Names: IMUP

Organism: Homo sapiens (Human)

AA Sequence: MEFDLGAALEPTSQKPGVGAGHGGDPKLSPHKVQGRSEAGAGPGPKASNFRGLGKGRRLTAAPPSSKDTTALPTPAAAPAIRTRM

Expression Region: 1-85aa

Sequence Info: Full Length of Isoform 2

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 35.5 kDa

Alternative Name(s): Hepatocyte growth factor activator inhibitor type 2-related small protein ;H2RSP ;HAI-2-related small protein

Relevance:

Reference: Identification of cDNAs encoding two novel nuclear proteins, IMUP-1 and IMUP-2, upregulated in SV40-immortalized human fibroblasts.Kim J.K., Ryll R., Ishizuka Y., Kato S.Gene 257:327-334(2000)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details