Gene Bio Systems
Recombinant Human HLA class II histocompatibility antigen, DRB1-14 beta chain(HLA-DRB1)
Recombinant Human HLA class II histocompatibility antigen, DRB1-14 beta chain(HLA-DRB1)
SKU:CSB-CF872375HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:Q9GIY3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:GDTRPRFLEYSTSECHFFNGTERVRFLDRYFHNQEEFVRFDSDVGEYRAVTELGRPAAEH WNSQKDLLERRRAEVDTYCRHNYGVVESFTVQRRVHPKVTVYPSKTQPLQHYNLLVCSVS GFYPGSIEVRWFRNGQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYTCQVEHPSV TSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPRGFLS
Protein Names:Recommended name: HLA class II histocompatibility antigen, DRB1-14 beta chain Alternative name(s): MHC class II antigen DRB1*14 Short name= DR-14 Short name= DR14
Gene Names:Name:HLA-DRB1
Expression Region:30-266
Sequence Info:full length protein
