Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human herpesvirus 7 Glycoprotein N (U46)

Recombinant Human herpesvirus 7 Glycoprotein N (U46)

SKU:CSB-CF345594HKB

Regular price £1,147.00 GBP
Regular price Sale price £1,147.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Human herpesvirus 7 (strain JI) (HHV-7) (Human T lymphotropic virus)

Uniprot NO.:P52366

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:NEVDGEELFYKPTCHSDTYEIILKKFSSIWILVNTFILLCSFSLFLKYWCFKTLAKETVK GY

Protein Names:Recommended name: Glycoprotein N Short name= gN

Gene Names:ORF Names:U46

Expression Region:25-86

Sequence Info:full length protein

View full details