Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human herpesvirus 6B Protein B4(B4)

Recombinant Human herpesvirus 6B Protein B4(B4)

SKU:CSB-CF879418HKA

Regular price £1,260.00 GBP
Regular price Sale price £1,260.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Human herpesvirus 6B (strain Z29) (HHV-6 variant B) (Human B lymphotropic virus)

Uniprot NO.:Q9QJ59

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MCVFFCVCIFLCVYFFVCIFLCVFFCVCIFLCVFFCVYFFVCVFFCVCFFVCVFFVCVYA FAHVAVCSVRPRRHVCACSRAYLHHRNGSGVYKKVIRPAGRSAHPPVGRFYTRPLFSLSR ATCGPSSGTSAPRPRWRSLTLGGAHGPRGRSLFPPASPRLSLCGSAFCLSFSLARAIVFS LSPGSGARLHLRL

Protein Names:Recommended name: Protein B4

Gene Names:Name:B4

Expression Region:1-193

Sequence Info:full length protein

View full details