Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human herpesvirus 6A Glycoprotein U24(U24)

Recombinant Human herpesvirus 6A Glycoprotein U24(U24)

SKU:CSB-CF724340HJZ

Regular price £1,169.00 GBP
Regular price Sale price £1,169.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Human herpesvirus 6A (strain Uganda-1102) (HHV-6 variant A) (Human B lymphotropic virus)

Uniprot NO.:Q69559

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDPPRTPPPSYSEVLMMDVMCGQVSPHVINDTSFVECIPPPQSRPAWNLWNNRRKTFSFL VLTGLAIAMILFIVFVLYVFHVNRQRR

Protein Names:Recommended name: Glycoprotein U24

Gene Names:Name:U24 Synonyms:EoLF1

Expression Region:1-87

Sequence Info:full length protein

View full details