Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human herpesvirus 1 Glycoprotein N(gN)

Recombinant Human herpesvirus 1 Glycoprotein N(gN)

SKU:CSB-CF520962HWY

Regular price £1,153.00 GBP
Regular price Sale price £1,153.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1)

Uniprot NO.:O09800

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:DAGPRGEPPGEEGGRDGIGGARCETQNTGQMSAPGALVPFYVGMASMGVCIIAHVCQICQ RLLAAGHA

Protein Names:Recommended name: Glycoprotein N Short name= gN Alternative name(s): Protein UL49.5 Protein UL49A

Gene Names:Name:gN ORF Names:UL49.5, UL49A

Expression Region:24-91

Sequence Info:full length protein

View full details