Skip to product information
1 of 1

GeneBio Systems

Recombinant Human herpesvirus 1 Accessory factor US11 (US11)

Recombinant Human herpesvirus 1 Accessory factor US11 (US11)

SKU:P04487

Regular price £735.00 GBP
Regular price Sale price £735.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: P04487

Gene Names: US11

Alternative Name(s): Vmw21

Abbreviation: Recombinant Human herpesvirus 1 US11 protein

Organism: Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1)

Source: E.coli

Expression Region: 1-161aa

Protein Length: Full Length

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Target Protein Sequence: MSQTQPPAPVGPGDPDVYLKGVPSAGMHPRGVHAPRGHPRMISGPPQRGDNDQAAGQCGDSGLLRVGADTTISKPSEAVRPPTIPRTPRVPREPRVPRPPREPREPRVPRAPRDPRVPRDPRDPRQPRSPREPRSPREPRSPREPRTPRTPREPRTARGSV

MW: 25.2 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Plays a role in the inhibition of host immune response. Participates in the inhibition of host autophagy by interacting with and inhibiting host PKR/EIF2AK2. This interaction also prevents the interferon-induced shut down of protein synthesis following viral infection. Downmodulates the host RLR signaling pathway via direct interaction with host DDX58 and IFIH1. Associates with endogenous HSP90 to disrupt the HSP90-TBK1 complex and induces destabilization of host TBK1 through a proteasome-dependent pathway. May also participate in nuclear egress of viral particles through interactions with host NCL and regulation of the viral UL34 mRNA.

Reference: "Phosphorylation of herpes simplex virus type 1 Us11 protein is independent of viral genome expression." Simonin D., Diaz J.-J., Kindbeiter K., Pernas P., Madjar J.-J. Electrophoresis 16: 1317-1322(1995)

Function:

View full details