Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Hemoglobin subunit gamma-1(HBG1)

Recombinant Human Hemoglobin subunit gamma-1(HBG1)

SKU:CSB-EP010155HU

Regular price £483.00 GBP
Regular price Sale price £483.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Signal Transduction

Uniprot ID:P69891

Gene Names:HBG1

Organism:Homo sapiens (Human)

AA Sequence:GHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTAVASALSSRYH

Expression Region:2-147aa

Sequence Info:Full Length of Mature Protein

Source:E.coli

Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW:23.0 kDa

Alternative Name(s):Gamma-1-globin (Hb F Agamma) (Hemoglobin gamma-1 chain) (Hemoglobin gamma-A chain)

Relevance:Gamma chains make up the fetal hemoglobin F, in combination with alpha chains.

Reference:"Fetal hemoglobin levels and morbidity in untransfused patients with beta-thalassemia intermedia." Musallam K.M., Sankaran V.G., Cappellini M.D., Duca L., Nathan D.G., Taher A.T. Blood 119:364-367(2012)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:Gamma chains make up the fetal hemoglobin F, in combination with alpha chains.

Involvement in disease:

Subcellular Location:

Protein Families:Globin family

Tissue Specificity:Red blood cells.

Paythway:

HGNC Database Link:https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=HGNC:4831

UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Hs&CID=702189

KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?hsa:3047

STRING Database Link:

OMIM Database Link:https://www.omim.org/entry/142200142200142200

Lead Time Guidance:3-7 business days

View full details