Skip to product information
1 of 1

GeneBio Systems

Recombinant Human Glucagon-like peptide 1 receptor (GLP1R), partial

Recombinant Human Glucagon-like peptide 1 receptor (GLP1R), partial

SKU:P43220

Regular price £417.00 GBP
Regular price Sale price £417.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Cardiovascular

Uniprot ID: P43220

Gene Names: GLP1R

Alternative Name(s):

Abbreviation: Recombinant Human GLP1R protein, partial

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 24-145aa

Protein Length: Partial

Tag Info: C-terminal 10xHis-tagged

Target Protein Sequence: RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY

MW: 15.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Regulates the coordinated translation of type I collagen alpha-1 and alpha-2 mRNAs, CO1A1 and CO1A2. Stabilizes mRNAs through high-affinity binding of a stem-loop structure in their 5' UTR. This regulation requires VIM and MYH10 filaments, and the helicase DHX9.

Reference: "Acheron, an novel LA antigen family member, binds to CASK and forms a complex with Id transcription factors." Weng H., Kim C., Valavanis C., Wang Z., Schwartz L.M. Cell Mol Biol Lett 14: 273-287(2009)

Function:

View full details