Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Gap junction epsilon-1 protein(GJE1)

Recombinant Human Gap junction epsilon-1 protein(GJE1)

SKU:CSB-CF009464HU

Regular price £1,271.00 GBP
Regular price Sale price £1,271.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:A6NN92

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSLNYIKNFYEGCVKPPTVIGQFHTLFFGSIRIFFLGVLGFAVYGNEALHFICDPDKREV NLFCYNQFRPITPQVSFSALQLVIVLVPGALFHLYAACKSINQECILQKPIYTIIYILSV LLRISLAAIAFWLQIYLFGFQVKSLYLCDARSLGENMIIRCMVPEHFEKTIFLIAINTFT TITILLFVAEIFEIIFRRLYFPFRQ

Protein Names:Recommended name: Gap junction epsilon-1 protein Alternative name(s): Connexin-23 Short name= Cx23

Gene Names:Name:GJE1

Expression Region:1-205

Sequence Info:Full length protein

View full details