Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Gamma-aminobutyric acid receptor-associated protein-like 2(GABARAPL2)

Recombinant Human Gamma-aminobutyric acid receptor-associated protein-like 2(GABARAPL2)

SKU:CSB-RP034844h

Regular price £529.00 GBP
Regular price Sale price £529.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Transport

Uniprot ID: P60520

Gene Names: GABARAPL2

Organism: Homo sapiens (Human)

AA Sequence: MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF

Expression Region: 1-117aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 40.7 kDa

Alternative Name(s): GABA(A) receptor-associated protein-like 2Ganglioside expression factor 2 ;GEF-2General protein transport factor p16Golgi-associated ATPase enhancer of 16KDA ;GATE-16MAP1 light chain 3-related protein

Relevance: Ubiquitin-like modifier involved in intra-Golgi traffic. Modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. It first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1 . Involved in autophagy. Plays a role in mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirents and preventing excess ROS production. Whereas LC3s are involved in elongation of the phagophore mbrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation.

Reference: Interaction of the Unc-51-like kinase and microtubule-associated protein light chain 3 related proteins in the brain possible role of vesicular transport in axonal elongation.Okazaki N., Yan J., Yuasa S., Ueno T., Kominami E., Masuho Y., Koga H., Muramatsu M.-A.Brain Res. Mol. Brain Res. 85:1-12(2000)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details