Gene Bio Systems
Recombinant Human Four and a half LIM domains protein 3(FHL3)
Recombinant Human Four and a half LIM domains protein 3(FHL3)
SKU:CSB-EP618796HU
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Tags & Cell Markers
Uniprot ID: Q13643
Gene Names: FHL3
Organism: Homo sapiens (Human)
AA Sequence: SESFDCAKCNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCRCQRSLADEPFTCQDSELLCNDCYCSAFSSQCSACGETVMPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRSFVPDKGAHYCVPCYENKFAPRCARCSKTLTQGGVTYRDQPWHRECLVCTGCQTPLAGQQFTSRDEDPYCVACFGELFAPKCSSCKRPIVGLGGGKYVSFEDRHWHHNCFSCARCSTSLVGQGFVPDGDQVLCQGCSQAGP
Expression Region: 1-280aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 58.1 kDa
Alternative Name(s): Skeletal muscle LIM-protein 2
Relevance:
Reference: "The LIM proteins FHL1 and FHL3 are expressed differently in skeletal muscle." Morgan M.J., Madgwick A.J.A. Biochem. Biophys. Res. Commun. 255:245-250(1999)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
