Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human ER lumen protein retaining receptor 2(KDELR2)

Recombinant Human ER lumen protein retaining receptor 2(KDELR2)

SKU:CSB-CF012130HU

Regular price £1,277.00 GBP
Regular price Sale price £1,277.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P33947

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNIFRLTGDLSHLAAIVILLLKIWKTRSCAGISGKSQLLFALVFTTRYLDLFTSFISLYN TSMKVIYLACSYATVYLIYLKFKATYDGNHDTFRVEFLVVPVGGLSFLVNHDFSPLEILW TFSIYLESVAILPQLFMISKTGEAETITTHYLFFLGLYRALYLVNWIWRFYFEGFFDLIA VVAGVVQTILYCDFFYLYITKVLKGKKLSLPA

Protein Names:Recommended name: ER lumen protein retaining receptor 2 Alternative name(s): ERD2-like protein 1 Short name= ELP-1 KDEL endoplasmic reticulum protein retention receptor 2 Short name= KDEL receptor 2

Gene Names:Name:KDELR2 Synonyms:ERD2.2

Expression Region:1-212

Sequence Info:Full length protein

View full details