Recombinant Human Endothelin-1 receptor(DNRA) ,partial

SKU: CSB-YP007403HU1

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Signal Transduction

Uniprot ID: P25101

Gene Names: DNRA

Organism: Homo sapiens (Human)

AA Sequence: DNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFK

Expression Region: 21-80aa

Sequence Info: Extracellular Domain

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 8.8 kDa

Alternative Name(s): Endothelin A receptor ;ET-A ;ETA-R ;hET-AR

Relevance: Receptor for endothelin-1. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger syst. The rank order of binding affinities for ET-A is: ET1 > ET2 >> ET3.

Reference: Cloning and characterization of cDNA encoding human A-type endothelin receptor.Adachi M., Yang Y.Y., Furuichi Y., Miyamoto C.Biochem. Biophys. Res. Commun. 180:1265-1272(1991)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.