Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Endoplasmic reticulum-Golgi intermediate compartment protein 1(ERGIC1)

Recombinant Human Endoplasmic reticulum-Golgi intermediate compartment protein 1(ERGIC1)

SKU:CSB-CF842630HU

Regular price £1,343.00 GBP
Regular price Sale price £1,343.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q969X5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPFDFRRFDIYRKVPKDLTQPTYTGAIISICCCLFILFLFLSELTGFITTEVVNELYVDD PDKDSGGKIDVSLNISLPNLHCELVGLDIQDEMGRHEVGHIDNSMKIPLNNGAGCRFEGQ FSINKVPGNFHVSTHSATAQPQNPDMTHVIHKLSFGDTLQVQNIHGAFNALGGADRLTSN PLASHDYILKIVPTVYEDKSGKQRYSYQYTVANKEYVAYSHTGRIIPAIWFRYDLSPITV KYTERRQPLYRFITTICAIIGGTFTVAGILDSCIFTASEAWKKIQLGKMH

Protein Names:Recommended name: Endoplasmic reticulum-Golgi intermediate compartment protein 1 Alternative name(s): ER-Golgi intermediate compartment 32 kDa protein Short name= ERGIC-32

Gene Names:Name:ERGIC1 Synonyms:ERGIC32, KIAA1181 ORF Names:HT034

Expression Region:1-290

Sequence Info:full length protein

View full details