Skip to product information
1 of 1

GeneBio Systems

Recombinant Human Early activation antigen CD69 (CD69), partial (Active)

Recombinant Human Early activation antigen CD69 (CD69), partial (Active)

SKU:Q07108

Regular price £277.00 GBP
Regular price Sale price £277.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Yes

Research Areas: Cancer

Uniprot ID: Q07108

Gene Names: CD69

Alternative Name(s): (Activation inducer molecule)(BL-AC/P26)(C-type lectin domain family 2 member C)(EA1)(Early T-cell activation antigen p60)

Abbreviation: Recombinant Human CD69 protein, partial (Active)

Organism: Homo sapiens (Human)

Source: Mammalian cell

Expression Region: 62-199aa

Protein Length: Partial

Tag Info: C-terminal 10xHis-tagged

Target Protein Sequence: SVGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK

MW: 18.7 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/μg as determined by LAL method.

Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CD69 at 2 μg/mL can bind Anti-CD69 recombinant antibody (CSB-RA004952MA1HU), the EC50 is 23.17-26.04 ng/mL.

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: May function as a signal transmitting receptor.

Reference: "Crystal structure of human CD69: a C-type lectin-like activation marker of hematopoietic cells." Natarajan K., Sawicki M.W., Margulies D.H., Mariuzza R.A. Biochemistry 39: 14779-14786(2000)

Function:

View full details