Recombinant Human E3 ubiquitin-protein ligase ZNRF3(ZNRF3),partial (Active)

Recombinant Human E3 ubiquitin-protein ligase ZNRF3(ZNRF3),partial (Active)

CSB-MP890933HU
Regular price
£389.00 GBP
Sale price
£389.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. Please contact us.

Research Areas:Cell Biology

Uniprot NO.:Q9ULT6

Uniprot Entry Name:

Gene Names:ZNRF3

Species:Homo sapiens (Human)

Source:Mammalian cell

Expression Region:56-219aa

Sequence:KETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGATLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHRPPRQPTEYFDM

Protein Description:Partial

Tag Info:C-terminal 6xHis-tagged

Mol. Weight:20.4 kDa

Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized Human ZNRF3 at 5 ?g/mL can bind Human RSPO2 (CSB-MP751021HU1(M)), the EC50 is 5.091-6.991 ng/mL.

Purity:Greater than 95% as determined by SDS-PAGE.

Endotoxin:Less than 1.0 EU/ug as determined by LAL method.

Form:Lyophilized powder

Buffer:Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Alternative Name/ Alias:(RING finger protein 203)(RING-type E3 ubiquitin transferase ZNRF3)(Zinc/RING finger protein 3)

Relevance:E3 ubiquitin-protein ligase that acts as a negative regulator of the Wnt signaling pathway by mediating the ubiquitination and subsequent degradation of Wnt receptor complex components Frizzled and LRP6. Acts on both canonical and non-canonical Wnt signaling pathway. Acts as a tumor suppressor in the intestinal stem cell zone by inhibiting the Wnt signaling pathway, thereby resticting the size of the intestinal stem cell zone . Along with RSPO2 and RNF43, constitutes a master switch that governs limb specification.

PubMed ID:

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Your list is ready to share