Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human E3 ubiquitin-protein ligase RNF125(RNF125)

Recombinant Human E3 ubiquitin-protein ligase RNF125(RNF125)

SKU:CSB-EP836205HU

Regular price £758.00 GBP
Regular price Sale price £758.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Cell Biology

Uniprot ID: Q96EQ8

Gene Names: RNF125

Organism: Homo sapiens (Human)

AA Sequence: GSVLSTDSGKSAPASATARALERRRDPELPVTSFDCAVCLEVLHQPVRTRCGHVFCRSCIATSLKNNKWTCPYCRAYLPSEGVPATDVAKRMKSEYKNCAECDTLVCLSEMRAHIRTCQKYIDKYGPLQELEETAARCVCPFCQRELYEDSLLDHCITHHRSERRPVFCPLCRLIPDENPSSFSGSLIRHLQVSHTLFYDDFIDFNIIEEALIRRVLDRSLLEYVNHSNTT

Expression Region: 1-232aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 53.3 kDa

Alternative Name(s): RING finger protein 125 T-cell RING activation protein 1

Relevance: E3 ubiquitin-protein ligase that acts as a positive regulator of T-cell activation. E3 ligase proteins mediate ubiquitination and subsequent proteasomal degradation of target proteins.

Reference: "Systematic identification of regulatory proteins critical for T-cell activation." Chu P., Pardo J., Zhao H., Li C.C., Pali E., Shen M.M., Qu K., Yu S.X., Huang B.C.B., Yu P., Masuda E.S., Molineaux S.M., Kolbinger F., Aversa G., de Vries J., Payan D.G., Liao X.C. J. Biol. 2:21.1-21.16(2003)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details