Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human E3 ubiquitin-protein ligase MARCH5(41338)

Recombinant Human E3 ubiquitin-protein ligase MARCH5(41338)

SKU:CSB-CF889137HU

Regular price £1,334.00 GBP
Regular price Sale price £1,334.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q9NX47

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPDQALQQMLDRSCWVCFATDEDDRTAEWVRPCRCRGSTKWVHQACLQRWVDEKQRGNST ARVACPQCNAEYLIVFPKLGPVVYVLDLADRLISKACPFAAAGIMVGSIYWTAVTYGAVT VMQVVGHKEGLDVMERADPLFLLIGLPTIPVMLILGKMIRWEDYVLRLWRKYSNKLQILN SIFPGIGCPVPRIPAEANPLADHVSATRILCGALVFPTIATIVGKLMFSSVNSNLQRTIL GGIAFVAIKGAFKVYFKQQQYLRQAHRKILNYPEQEEA

Protein Names:Recommended name: E3 ubiquitin-protein ligase MARCH5 EC= 6.3.2.- Alternative name(s): Membrane-associated RING finger protein 5 Membrane-associated RING-CH protein V Short name= MARCH-V Mitochondrial ubiquitin ligase Shor

Gene Names:Name:MARCH5 Synonyms:RNF153

Expression Region:1-278

Sequence Info:full length protein

View full details