Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human E3 ubiquitin-protein ligase MARCH3(41336)

Recombinant Human E3 ubiquitin-protein ligase MARCH3(41336)

SKU:CSB-CF774802HU

Regular price £1,312.00 GBP
Regular price Sale price £1,312.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q86UD3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTTSRCSHLPEVLPDCTSSAAPVVKTVEDCGSLVNGQPQYVMQVSAKDGQLLSTVVRTLA TQSPFNDRPMCRICHEGSSQEDLLSPCECTGTLGTIHRSCLEHWLSSSNTSYCELCHFRF AVERKPRPLVEWLRNPGPQHEKRTLFGDMVCFLFITPLATISGWLCLRGAVDHLHFSSRL EAVGLIALTVALFTIYLFWTLVSFRYHCRLYNEWRRTNQRVILLIPKSVNVPSNQPSLLG LHSVKRNSKETVV

Protein Names:Recommended name: E3 ubiquitin-protein ligase MARCH3 EC= 6.3.2.- Alternative name(s): Membrane-associated RING finger protein 3 Membrane-associated RING-CH protein III Short name= MARCH-III RING finger protein 173

Gene Names:Name:MARCH3 Synonyms:RNF173

Expression Region:1-253

Sequence Info:full length protein

View full details