Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human cytomegalovirus Transmembrane protein HWLF4(US19)

Recombinant Human cytomegalovirus Transmembrane protein HWLF4(US19)

SKU:CSB-CF300194HWX

Regular price £1,302.00 GBP
Regular price Sale price £1,302.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Human cytomegalovirus (strain Towne) (HHV-5) (Human herpesvirus 5)

Uniprot NO.:P69337

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLHVVPLEWTVEEVVPYLERLAVWLRASVLVAFQLTATVALSVLSWWLMPPPVAELCERG RDDDPPPLSHLSLVVPVGCLFLLLRGPSIDRCPRKLPLLLAYCLPHALAFLTLLMCQPSP QAFVGAALLALAVDLSCLGASLLGCDPGASLRRLWLPSVLSLLCATALGLWLLRAAAPFF LGLHATTLLTVTLMLIHDLSLITCQSSFPESFQPSLRLYVENVALFIGMYHLLRLWLWSP

Protein Names:Recommended name: Transmembrane protein HWLF4

Gene Names:Name:US19

Expression Region:1-240

Sequence Info:full length protein

View full details