Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human cytomegalovirus Enhanced green fluorescent protein(egfp)

Recombinant Human cytomegalovirus Enhanced green fluorescent protein(egfp)

SKU:CSB-YP2069HIZ

Regular price £959.00 GBP
Regular price Sale price £959.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Microbiology

Uniprot ID: C5MKY7

Gene Names: egfp

Organism: Human cytomegalovirus (HHV-5) (Human herpesvirus 5)

AA Sequence: MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Expression Region: 1-239aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW: 30.9 kDa

Alternative Name(s):

Relevance:

Reference: "Bacterial artificial chromosome clones of viruses comprising the towne cytomegalovirus vaccine."Cui X., Adler S.P., Davison A.J., Smith L., Habib el.-S.E., McVoy M.A.J. Biomed. Biotechnol. 2012:428498-428498(2012)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details