Skip to product information
1 of 1

GeneBio Systems

Recombinant Human Cell surface glycoprotein CD200 receptor 1 (CD200R1), partial

Recombinant Human Cell surface glycoprotein CD200 receptor 1 (CD200R1), partial

SKU:Q8TD46

Regular price £586.00 GBP
Regular price Sale price £586.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Cardiovascular

Uniprot ID: Q8TD46

Gene Names: CD200R1

Alternative Name(s): CD200 cell surface glycoprotein receptor;Cell surface glycoprotein OX2 receptor 1

Abbreviation: Recombinant Human CD200R1 protein, partial

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 226-325aa

Protein Length: Partial

Tag Info: N-terminal 6xHis-KSI-tagged

Target Protein Sequence: SLYIELLPVPGAKKSAKLYIPYIILTIIILTIVGFIWLLKVNGCRKYKLNKTESTPVVEEDEMQPYASYTEKNNPLYDTTNKVKASEALQSEVDTDLHTL

MW: 26.7 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Inhibitory receptor for the CD200/OX2 cell surface glycoprotein. Limits inflammation by inhibiting the expression of pro-inflammatory molecules including TNF-alpha, interferons, and inducible nitric oxide synthase (iNOS) in response to selected stimuli. Also binds to HHV-8 K14 viral CD200 homolog with identical affinity and kinetics as the host CD200.

Reference:

Function:

View full details