Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human cDNA FLJ56323, highly similar to Methylated-DNA--protein-cysteinemethyltransferase (EC 2.1.1.63),partial

Recombinant Human cDNA FLJ56323, highly similar to Methylated-DNA--protein-cysteinemethyltransferase (EC 2.1.1.63),partial

SKU:CSB-RP118594h

Regular price £584.00 GBP
Regular price Sale price £584.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Epigenetics and Nuclear Signaling

Uniprot ID: B4DEE8

Gene Names: N/A

Organism: Homo sapiens (Human)

AA Sequence: QPAPLERFASRRPQVLAVRTVCDLVLGKMDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN

Expression Region: 4-238aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 28.7 kDa

Alternative Name(s):

Relevance:

Reference: "Identification of single nucleotide polymorphisms in human DNA repair genes."Ford B.N., Ruttan C.C., Kyle V.L., Brackley M.E., Glickman B.W.Carcinogenesis 21:1977-1981(2000)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details