Skip to product information
1 of 1

GeneBio Systems

Recombinant Human CD79A&CD79B Heterodimer Protein (Active)

Recombinant Human CD79A&CD79B Heterodimer Protein (Active)

SKU:P11912&P40259

Regular price £371.00 GBP
Regular price Sale price £371.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Yes

Research Areas: Immunology

Uniprot ID: P11912&P40259

Gene Names: CD79A&CD79B

Alternative Name(s): /

Abbreviation: Recombinant Human CD79A&CD79B Heterodimer protein (Active)

Organism: Homo sapiens (Human)

Source: Mammalian cell

Expression Region: 33-143aa&29-159aa

Protein Length: Heterodimer

Tag Info: C-terminal mFc-Flag-tagged&C-terminal 10xHis-mFC-tagged

Target Protein Sequence: LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNR&ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD

MW: 41.3 kDa&43.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/μg as determined by LAL method.

Biological_Activity: ①Measured by its binding ability in a functional ELISA. Immobilized Human CD79A&CD79B at 2 μg/mL can bind Anti-CD79A recombinant antibody(CSB-RA004957MA1HU). The EC50 is 8.012-9.339 ng/mL. ②Measured by its binding ability in a functional ELISA. Immobilized Human CD79A&CD79B at 2 μg/mL can bind Anti-CD79B recombinant antibody(CSB-RA004958MA2HU). The EC50 is 14.85-17.47 ng/mL.

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: /

Reference: /

Function:

View full details